PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 378aa    MW: 42783.4 Da    PI: 9.8101
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32513.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-18249295148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd  l+++v+q+G++ W+ Ia+ +  gR +kqc++rw+++l
       KHN32513.1 249 KGQWTSEEDSALLELVNQFGPKKWSQIAKLLH-GRIGKQCRERWYNHL 295
                      799*****************************.*************97 PP

2Myb_DNA-binding55.51.3e-17301343145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+W+ eEd++l++a+k +G++ W++I ++++ gRt++ +k+rw+
       KHN32513.1 301 KGPWSVEEDQILIEAHKIYGNK-WTKIGERLP-GRTENTIKNRWN 343
                      79********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.988244299IPR017930Myb domain
SuperFamilySSF466899.16E-32247342IPR009057Homeodomain-like
SMARTSM007176.2E-16248297IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-24250299IPR009057Homeodomain-like
PfamPF139212.1E-17252309No hitNo description
CDDcd001671.38E-15252295No hitNo description
PROSITE profilePS5129422.721300350IPR017930Myb domain
SMARTSM007171.2E-17300348IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-22300348IPR009057Homeodomain-like
CDDcd001679.27E-14303343No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDFGSSFQRP QYLSSLFPRN SCLMPQTQAM FPSQNSIHVP LSPPLPAMFH PNNTFHHFQD  60
PIMNGPTHNP PFAMNGPFNP ITTPMYGIPT PALGDGSSLS GFVNVHHHHP VTLAPNNNKM  120
EGLVSHNPSF IMNGPSNSIT TPMYGIPTPS LGDGSSLGGF VNIHHHHHVT LDPNNNKMEA  180
LYGHHKGKHI LDFSQNAMMH PYEASSSKSP LPFSLSNVYE WGISEYHQDI DWKVKMTNDS  240
NIANDKIIKG QWTSEEDSAL LELVNQFGPK KWSQIAKLLH GRIGKQCRER WYNHLQPNIK  300
KGPWSVEEDQ ILIEAHKIYG NKWTKIGERL PGRTENTIKN RWNGTKRRQN FKKHNKNNQT  360
PYEGSMLHAY IKKVTATK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-412463491104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576584.10.0PREDICTED: uncharacterized protein LOC102665467
TrEMBLA0A0B2RKM50.0A0A0B2RKM5_GLYSO; Transcription factor MYB98
TrEMBLK7KDK20.0K7KDK2_SOYBN; Uncharacterized protein
STRINGGLYMA03G15870.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143361018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-48myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]